PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_010171
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family SBP
Protein Properties Length: 538aa    MW: 59232.6 Da    PI: 7.4199
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_010171genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.73e-42174249277
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  Cqv gC++dls++k+yh+rhkvCevhsk+p+v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk++
  DCAR_010171 174 CQVYGCKKDLSSCKDYHKRHKVCEVHSKTPKVIVNGIEQRFCQQCSRFHLLVEFDDGKRSCRKRLAGHNERRRKPH 249
                  **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.0E-34170235IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.898171248IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-39172252IPR004333Transcription factor, SBP-box
PfamPF031103.4E-31174247IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MESWSYVSGE RGFVSEDSAT ASDVIARDRN GSMDWEFKSL FYGSDNNIEL GPSSQEGIES  60
MGIIDLGVQE TMRKSVSNGS IKDAYGNKLN GIRMFENAFW GGEESNSKLS SSFVEFTGAE  120
SSLIDLKLGR FDDQRDARKL SAYRVAPSSC SNDSASKTGK RMRVGGLNSL TPYCQVYGCK  180
KDLSSCKDYH KRHKVCEVHS KTPKVIVNGI EQRFCQQCSR FHLLVEFDDG KRSCRKRLAG  240
HNERRRKPHM GMHSGRSGRL YQTYGSAASR FQGTVVSTLS FNHQDILPGC LPQQQKSERN  300
YWPGHVKLEE GADYSSQSAI TVAVGGLHSK SLFSSYGFDK HCQPEERIGA FEDLGSKSNG  360
NRDQYLVRNT SFGGEAYNNF DSTVTVQALS GFSDSGRALS LLSSQSQTSM SHTSGTLMAY  420
PLISPSSHGH YSETQASEKL LGMSPQTSRN EMSNKFASSG IKSTENHLNH MITTSGSNAV  480
VNYGIDGMFH GSGYMNSKEQ LSCEGGTIDL LQLSSQLQQV EDQRQSLHEK PENDSFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-281742471184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007037628.11e-161LIGULELESS1 protein, putative
TrEMBLA0A061G5241e-161A0A061G524_THECC; LIGULELESS1 protein, putative
STRINGVIT_17s0000g05020.t011e-158(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.16e-46SBP family protein